PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10024218
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 293aa    MW: 32713.6 Da    PI: 8.0411
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10024218genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++ + g+ R+ k+c++rw +yl
      Lus10024218 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTHTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.21.4e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Lus10024218  67 RGNFTQEEEKMIIHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-25564IPR009057Homeodomain-like
PROSITE profilePS5129425.617965IPR017930Myb domain
SuperFamilySSF466894.21E-3111108IPR009057Homeodomain-like
SMARTSM007175.8E-141363IPR001005SANT/Myb domain
PfamPF002499.9E-171461IPR001005SANT/Myb domain
CDDcd001678.19E-121661No hitNo description
Gene3DG3DSA:1.10.10.609.8E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129421.03366116IPR017930Myb domain
SMARTSM007177.7E-1766114IPR001005SANT/Myb domain
PfamPF002491.7E-1567112IPR001005SANT/Myb domain
CDDcd001679.16E-1269111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGRPPCCEKA GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTHTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TQEEEKMIIH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLNNNK  120
NYHHHHHSTS SSSDSNRGKW ERRLQTDIGL AKQALSDALS LHSKKPTTTE EEKSKLPLDN  180
PPNYASSTDN IARLLQNWIK KPPTKVPIAP AEMKSDVTQN SVSSSSGDDN DNFELLFGFH  240
NNSSPNSEGG SQSVDEEGII IMDERKPVRV EDHGVSSWGS PPDALAAGEM AL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-271411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003621186.21e-106R2R3-myb transcription factor
RefseqXP_012488913.11e-107PREDICTED: myb-related protein 306
RefseqXP_015879369.11e-106PREDICTED: myb-related protein 306
SwissprotP813921e-100MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D2T8E91e-107A0A0D2T8E9_G
TrEMBLA0A0L9VNM01e-106A0A0L9VNM0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T8G81e-106A0A0S3T8G8_PHAAN; Uncharacterized protein
TrEMBLQ2HVT21e-106Q2HVT2_MEDTR; Homeodomain-related
STRINGGLYMA09G37340.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.13e-88myb domain protein 94